SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004750430.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004750430.1.14098
Domain Number 1 Region: 76-177
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 170-215
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000196
Family SOCS box-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004750430.1.14098
Sequence length 216
Comment PREDICTED: suppressor of cytokine signaling 1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MVAHNQVAADNAISTAAESRRRPEPSSSSSSSSSSAAPAAPARPRPSPAAQAPAPGDTHF
RTFRSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFAL
SVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQ
ELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
Download sequence
Identical sequences M3Z8K3
XP_004750430.1.14098 ENSMPUP00000019917 ENSMPUP00000019917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]