SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004751227.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004751227.1.14098
Domain Number 1 Region: 252-776
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.38e-145
Family Lysophospholipase 0.000000428
Further Details:      
 
Domain Number 2 Region: 6-129
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-28
Family Synaptotagmin-like (S variant) 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004751227.1.14098
Sequence length 783
Comment PREDICTED: cytosolic phospholipase A2 beta isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MALAKIPGTCLLTVRVLQARGLPSKDLVTPSDCYVSLWLPTASSHRLQTRTVKNSRNPIW
NQSFRFRIHSQLKNVLQLQVFDQDLLTSDDPMLSVLFDLGTLQAGDFRRESFSLNPQGEE
RLEVEFRLQRLTDCAEQLVSNGILVARELSCLHVRLEEAGDQKQSEGRVQLVVPGSCEGQ
QEASVGAGPVCFHCPACWEQELGILLQGAPREQLKVPLSALPSGQVVRLVFPTSQEPLMR
VELRKEGPKELAVRLGCGPCAEEQAFLSRRKQLVARALKQVLQLDDDLQEDEVPVVAVMA
TGGGIRAMLSLYGQLAGLRELGLLDCVSYITGASGSTWALTNLYEDPEWSQKDLAGPTES
LKTQVTKSKLGVLAPSQLQRYRQELAERARLGHPPCFTNLWALISEGLLHEEPRDCTLSD
QREALSRGQNPLPIYCALNTKEKGLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEFF
MGRLTKRLPESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWAQDQASRDKEQVPLL
KIEEPPTGAGRIAEFFTDLLTRRPLAQATHNFLRGLHFHKDYFHDPYFSTWKATKLDGFP
NQLTPAEPHLCLLDVGYLINTSFPPLLRPTRDVDLVLSLDYNLEGAFQQLQLLGRLCGEQ
GIPFPPISPSPEEQCQPRECHLFLDPDCPDAPAVLHFPLVDDSFREYSAPGIPRTPTEKA
AGEVNLSPSDSPYHYSKLTYSLEDADKLLRLTHYNICNNREQLLEALRGAVLRRRQRQHH
QPQ
Download sequence
Identical sequences M3YCN4
ENSMPUP00000009091 ENSMPUP00000009091 XP_004751227.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]