SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004753328.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004753328.1.14098
Domain Number 1 Region: 559-694
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.83e-40
Family Synaptotagmin-like (S variant) 0.00000034
Further Details:      
 
Domain Number 2 Region: 391-524
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.41e-37
Family Synaptotagmin-like (S variant) 0.003
Further Details:      
 
Domain Number 3 Region: 49-168
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.44e-34
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.000000844
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004753328.1.14098
Sequence length 702
Comment PREDICTED: rabphilin-3A isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MTDTVFSNSSSRWMCPSDRPLQSNDKEQLQAGWSVHPSGQPDRQRKQEELTDEEKEIINR
VIARAEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKK
NVCTKCGVETSNNRPHPVWLCKICLEQREVWKRSGAWFFKGFPKQVLPQPMPIKKTKPQQ
PVTEPAVPEQVTPEPKHAARVPSRGDTEDRRGLGQKTGPEPASAPGRGSYGPPVRRASEA
RMSSTSRDSESWDHGHGGAAGDSSRNPAGLRRANSVQASRPAPATMQSPAPPQAAQPGPP
GGSKPGTGPAGRFPDQRPEVAPGDSGYAGATAPPREERTGGVGGYSAVGARDDRAGPPLG
PYSQASAAAPQPAVAPARQPPPPEEEEEEANSYDSDEATTLGALEFSLLYDQDNSSLHCT
IIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWNETLVYHGITDDD
MQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKPNQKKNFNICLERVIPMKRAGTTGSAR
GMALYEEEQVERIGDIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKL
WLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIG
GCQLGISAKGERLKHWYECLKNKDKKIERWHQLQNENHVSSD
Download sequence
Identical sequences M3XTV8
XP_004753328.1.14098 XP_004753329.1.14098 ENSMPUP00000002508 ENSMPUP00000002508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]