SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004753602.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004753602.1.14098
Domain Number 1 Region: 225-499
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-82
Family Protein kinases, catalytic subunit 0.0000000626
Further Details:      
 
Domain Number 2 Region: 121-264
Classification Level Classification E-value
Superfamily SH2 domain 8.89e-40
Family SH2 domain 0.000049
Further Details:      
 
Domain Number 3 Region: 38-170
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-24
Family SH3-domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004753602.1.14098
Sequence length 515
Comment PREDICTED: tyrosine-protein kinase FRK isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MGNVCLRFWAYLRPCLPCLFQEADKPGVVIENPMARCSPGPPQLQSQEPGRSHGHYFVAL
FDYQARTAEDLSFRTGDKLQVLDTSREGWWFARHLEKRGDGSGQPLQGYIPSNYVAEDRS
LQAEPWFFGAIKRTDAEKQLLYSENQTGAFLIRESESQKGDFALSVLDERAVKHYRIRRL
DEGAFFLTQRRTFSTLNEFVSYYTKTSDGLCVQLGKPCLKIQVPVPFDLSYKTADQWEID
RKSIQLLKRLGSGQFGEVWEGLWNNTTSVAVKTLKPGSMDPNDFLREAQIMKNLRHPKLI
QLYAVCTLEDPIYIITELMRHGSLQEYLQNDAGTKIHLPQQVDMAAQVASGMAYLESQNY
IHRDLAARNVLVGEHNIYKVADFGLARVFKVGNEDIYESKHEIKLPVKWTAPEAIRANKF
SIKSDVWSFGILLYEIITYGKMPYTGMTGAQVIQILGQNYRLPQPPNCPPQFYNIMWECW
NADPKERPTFEKLHWKLEDYFETDFSFSDTNNFVR
Download sequence
Identical sequences M3YFV3
ENSMPUP00000010210 ENSMPUP00000010210 XP_004753602.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]