SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004754029.2.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004754029.2.14098
Domain Number 1 Region: 134-191
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000263
Family Myb/SANT domain 0.00013
Further Details:      
 
Weak hits

Sequence:  XP_004754029.2.14098
Domain Number - Region: 35-102
Classification Level Classification E-value
Superfamily BRCT domain 0.00414
Family BRCT domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004754029.2.14098
Sequence length 401
Comment PREDICTED: telomeric repeat-binding factor 2-interacting protein 1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAETMEFGKDPNGLTHSSTLFVREDGSSMSFYVRPSPAKRRVSTLILHGGGTLCRVQEPG
AVLLAQPGEAAAEASGDFISTQYIMDCVDRNERLDLDDYRLGSAADQAPETKAGAQAEGG
AAAAAQSEPQPHGGRIAFTDADDVAILTYVKENARSASSVTGTALWKAMEKSSLTQHSWQ
SLKDRYLKHLRGQEHKYLLGDAPVSPSSQKLKRKAEQDPEAADSGEPQNKRTPDLPEEEY
VKEEIKENDEAVKKMLVEATREFEEIVVDESPDFEIHITMCDDDPPTPEEDSETQPDEDE
EEEEEEKVSAPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSSFLESGQRADG
YPIWSRQDDLDLQKDDEDARDALVKKFGAQNVARRIEFRKK
Download sequence
Identical sequences M3YEN6
XP_004754029.2.14098 ENSMPUP00000009793 ENSMPUP00000009793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]