SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004754080.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004754080.1.14098
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.91e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000423
Further Details:      
 
Domain Number 2 Region: 259-458
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.31e-61
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000158
Further Details:      
 
Domain Number 3 Region: 597-760
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 9.81e-40
Family AlaX-like 0.039
Further Details:      
 
Domain Number 4 Region: 515-593
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000177
Family AlaX-M N-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004754080.1.14098
Sequence length 968
Comment PREDICTED: alanine--tRNA ligase, cytoplasmic [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPVERLYVTYFGGDEAAGLEPDLECKQIWQNLGLDDSKILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNRESDGILKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYSGKVGADDADGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDCKTIPGDTAWLLYDTYGF
PVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELREKGLEA
TDDSPKYNYHSDSSGSYAFESAVATVMALRRDKMFVEEVCTGQECGVVLDKTCFYAEQGG
QIYDEGYLVKVEDNSEDKTEFTVKNAQVRGGYVLHIGTVYGSLRVGDQVRLFIDEPRRRP
IMSNHTATHILNFALRSVLGEADQRGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANQMI
EAAKPVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSI
EFCGGTHLRNSSHAGTFVIVSEEAIAKGIRRIVAVTGAEAQKALRKAESLKNSLSVMEAK
VKAQTAPNKDVQREIADLGEALATAVIPQWQKDEFRENLKSLKKIMDDLDRASKADVQKR
VLEKTKQLIDSNPNQPLVILEMESGASAKALNEALKLFKTHSPQTSAMLFTVDNEAGKIT
CLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALELATSFAQ
LRLGDVKN
Download sequence
Identical sequences M3YF78
ENSMPUP00000009985 ENSMPUP00000009985 XP_004754080.1.14098 XP_012912475.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]