SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004754236.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004754236.1.14098
Domain Number 1 Region: 32-169
Classification Level Classification E-value
Superfamily PX domain 1.96e-16
Family PX domain 0.006
Further Details:      
 
Domain Number 2 Region: 203-401
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000241
Family BAR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004754236.1.14098
Sequence length 404
Comment PREDICTED: sorting nexin-5 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSEREKVKFTVHTKTTLSTFQN
PEFSVTRQHEDFVWLHDTLIETADYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEE
FAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTK
EVFGGFFKSVVKSADEVLFSGVKEVDDFFEQEKNFLINYYNRIKDSCAKADKMTRSHKNV
ADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVESRVSSDEDLKLTELLRYYML
NIEAAKDLLYRRTKALTDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEE
LVNFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN
Download sequence
Identical sequences M3XQE1
ENSMPUP00000001291 XP_004754236.1.14098 XP_004754237.1.14098 ENSMPUP00000001291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]