SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004755084.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004755084.1.14098
Domain Number 1 Region: 249-309
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.98e-19
Family Erythroid transcription factor GATA-1 0.00012
Further Details:      
 
Domain Number 2 Region: 201-247
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000095
Family Erythroid transcription factor GATA-1 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004755084.1.14098
Sequence length 414
Comment PREDICTED: erythroid transcription factor [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MEFPGLGALGTSEPLPQFVDPALVSSPPESGVFFSSGPEGLDAAASSTAPSTATAAAAAL
AYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYASWTYSKTGLYPAAAVCPTREDSPPQA
PEDPDGKGGSSFLETLKTERLSPDLLTLGPALPSSIPVPSSAYGGPDFSSTFFSPTGSPL
NPAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRP
LIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKD
GIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEMASGLTLGPPST
AHLYQGLGPVVLSGPVSHLVPFPGPLLGSPTGSFPAGPVPPTTTTTTVVAPLSS
Download sequence
Identical sequences M3YQE4
ENSMPUP00000013553 ENSMPUP00000013553 XP_004755084.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]