SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004755141.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004755141.1.14098
Domain Number 1 Region: 112-214
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-26
Family PDZ domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004755141.1.14098
Sequence length 328
Comment PREDICTED: PDZ domain-containing protein MAGIX [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MEPRARGATDPRGSRGGRDLPLQSGPRARQLLARLDARPLAARAAADVAALVRRTGATLR
LRPKAAVSVLDSADIEVTDSRLPNPTFVEHRPQHHRSVTLGTGTAPPQVTRSKACSASKL
LQTSGRFCVELVRDSTGFGLTLSGGQDSSGDAPLAVRGLLRNGPAQRCGRLQAGDLVLHI
NGESTRGLTHAQVVERIRTGGPRLRLVLRRPLESHPGEPEGAGGPEKGDGLPSPDRSPDP
GGPEVVRSHTVSASPLPHRRGSPEPSPEPLADCPAVPPPQRRTDDPNDRTPGSPGPWLVP
SEERLSRALGIPGAPQLALEMVAGRRRH
Download sequence
Identical sequences M3YQV1
ENSMPUP00000013710 XP_004755141.1.14098 ENSMPUP00000013710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]