SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004756968.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004756968.1.14098
Domain Number 1 Region: 419-567
Classification Level Classification E-value
Superfamily TRAF domain-like 1.37e-51
Family MATH domain 0.0000000562
Further Details:      
 
Domain Number 2 Region: 379-417
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.000000000000445
Family Trimerization domain of TRAF 0.00041
Further Details:      
 
Domain Number 3 Region: 79-125
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000542
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  XP_004756968.1.14098
Domain Number - Region: 156-212
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00131
Family SIAH, seven in absentia homolog 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004756968.1.14098
Sequence length 569
Comment PREDICTED: TNF receptor-associated factor 2 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MVSSGRSGAAWPRVTHAGAATGPRSAPFLRPPRFMGLRSRWAERARWCAALMAAAGATPP
GSLDLLQPGFSKTLLGTKPEDKYLCSACRNVLRRPFQAQCGHRYCSSCLTSILSSGPQNC
AACVHEGIYEEGVSILESGSAFPDNAARREVESLPAVCPSDGCTWTGTLKEYESCHEGHC
PFMLTECPACKGLVRLGEKERHSEHECPERSLSCRHCRAPCCWADMKAHHEVCPKFPLTC
DGCGKKKIPREKFQDHVRACGKCRLPCRFHVVGCPELVESEKQPQHEAHWLREHLAMLLG
GLLEAKPLSGAGDPFLSQSEMGGWEASTLLPKAAELQQRCEALERKTATFENIVCVLNRE
VERVAMTAEACGRQHRLDQDRIEALSNKVQQLERSIGLKDLAMAELEQKVHEMEATTFDG
VFVWKISDFARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFV
VMKGPHDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLF
CPVSKMEAKNSYVRDDAIFIKAIVDLTGL
Download sequence
Identical sequences M3YHU6
ENSMPUP00000010903 XP_004756968.1.14098 ENSMPUP00000010903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]