SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004757311.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004757311.1.14098
Domain Number 1 Region: 203-320
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-24
Family SH2 domain 0.0007
Further Details:      
 
Domain Number 2 Region: 565-721
Classification Level Classification E-value
Superfamily Ras GEF 3.53e-21
Family Ras GEF 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004757311.1.14098
Sequence length 857
Comment PREDICTED: SH2 domain-containing protein 3C isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MTEGPKKASRKFKFFKFKGLGSLSNLPRSFTLKRSSTTLSLGSHLEPDPFEATQDDMVTV
PKSPPAYARSSDMYSHMGTMPRLSTRKARDQQATQETKEVDQPHLAPQGLPNPPGLEATK
EMVVGTSVPLEDTLAVGPNPSAMGPTEKPEDLRADGKEERGPRNVPPERVAGEPEAGGDY
VKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIR
DSLTSLGDYVLTCRWRNQALHFKINKVVVKAGESYTHIQYLFEQESFDHVPALVRYHVGS
RKAVSEQSGAIIYCPVNRTFPLRYLEACYGLGQGSGKAASPASPSGPKGSHMKRRSVTMT
DGLTADKVTRSDGCPTSTSLPHPRESIRNCALSMDQIPDLHSPMSPISESPSSPAYSTVT
RVHATPTAPSATVLPASPVTRRSSEPQLCPGSAPKPPGESDKGPYASPSHTLSKASPSPS
LSSYSDPDSGHYCQLQPPVRGSREWAAAEASSRQARSYGERLKELSENGAPEGDWGRAFI
APVVEATSSFNPATFQSLLIPKDNRPLEVGLLRKVKELLAEVDARTLARHVTKVDCLVAR
ILGVTKEMQTLMGVRWGMELLTLPHGRQLRLDLLERFHTMSIMLAVDILGCTGSAEERAV
LLHKTIQLAAELRGTMGNMFSFAAVMGALDMAQIARLEQTWVTLRQRHTEGAILYEKKLK
PFLKSLNEGKEGPPLSNTTFPHVLPLITLLECDSAPAEGPEPWGSTEHGVEVVLAHLEAA
RTVAHHGGLYHTNAEVKLQGFQARPELLEVFSTEFQMRLLWGSQGASSNQARRYEKFDKV
LTALSHKLEPAVRSSEL
Download sequence
Identical sequences M3YQH3
ENSMPUP00000013582 ENSMPUP00000013582 XP_004757311.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]