SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004757505.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004757505.1.14098
Domain Number 1 Region: 241-452
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2e-52
Family Reprolysin-like 0.0012
Further Details:      
 
Domain Number 2 Region: 543-599
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.49e-16
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 891-952
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000327
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 4 Region: 841-895
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000994
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004757505.1.14098
Sequence length 953
Comment PREDICTED: A disintegrin and metalloproteinase with thrombospondin motifs 1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MGNAEPARRPRGSQPAPALLLLAAATTLLLLPGARGRPAEEDEELVQPALERAPGHTTTH
LRLDAFGRRLHLELQPDRGFLAPGFTLQTVGRRPGPDALGPDAAGDLAHCFYSGTVNGDS
GSAAALSLCEGVRGAFYLQGEEYFIQPAPVAATVRLAPAAAAAAAAGEEPPERPQFHLLR
RRRRGGGGAKCGVTDDETRLGRGEGPAGEDAGAQWPRRGPAPQRAGQPTGTGSIRKKRFV
SSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSVSLVVVKILVIYE
EQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDGEHYDTAILFTRQDLCGAQTCDTLGMAD
VGTICDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCAGINGIDQNSHMMASML
SNLNHSQPWSPCSAYMITSFLDNGHGECLMDKPQSPIQLPSDLPGTLYDANRQCQFTFGE
ESKHCLDAASTCTTLWCTGTSGGLLVCQTKHFPWADGTSCAEGRWCINGKCVNKTDKMHF
HTPVHGSWGPWGPWGECSRTCGGGVQYTMRECDNPVPKNGGKYCEGKRVRYRSCNIEDCP
DNNGKTFREEQCEAHNEFSKVSFGSGPAVEWTPKYAGVSPKDRCKLICQAKGVGFFFVLQ
PKVVDGTPCSPDSTSVCVQGQCVKAGCDRIIDSKKKFDKCGVCGGNGSTCKKTSGSVTSA
KPGYHDIITIPAGATNIEVKQRNHRGSRNNGSYLAIKAADGTYILNGDFTLSTLEQDISY
KGTVLRYSGSSASLERIRSFSPLTEPITIQVLTVGNAFRPKIKYTYFVKKKKESFNAIPT
FSEWVIEEWSECSKSCGLGWQRRLVECRDINGQPASECAKEVKPASTRPCADLPCPHWQL
GDWSPCSKTCGKGYKKRTLQCLSQDGGVLSHESCDPLKKPKHYIDFCTMAECS
Download sequence
Identical sequences M3XPK5
ENSMPUP00000001005 XP_004757505.1.14098 ENSMPUP00000001005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]