SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004757698.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004757698.1.14098
Domain Number 1 Region: 441-501
Classification Level Classification E-value
Superfamily SH3-domain 5.62e-23
Family SH3-domain 0.00054
Further Details:      
 
Weak hits

Sequence:  XP_004757698.1.14098
Domain Number - Region: 47-104
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00741
Family SNARE fusion complex 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004757698.1.14098
Sequence length 507
Comment PREDICTED: abl interactor 1 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQAADKRKALEETKAYTTQSLAS
VAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSR
THKIIAPANMERPVRYIRKPIDYTVLDDVGHGVKWLKAKHGNNQPARTGTLSRTNPPTQK
PPSPPMSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHS
GSSGGSGSRENSGSSSIGIPIAVPTPSPPTVGPENISVPPPSGAPPAPPLPPLLPGNTVI
APGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAPFSAQPHVNGGPLYSQNSIS
IAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPIFDDSPPPPPPPPVDY
EDEEAAVVQYSDPYADGDPAWAPKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDD
GWYEGVCNRVTGLFPGNYVESIMHYTD
Download sequence
Identical sequences M3YLF9
ENSMPUP00000012166 XP_004757698.1.14098 ENSMPUP00000012166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]