SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004758195.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004758195.1.14098
Domain Number 1 Region: 89-204
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-19
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004758195.1.14098
Sequence length 312
Comment PREDICTED: PDZ domain-containing protein GIPC2 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MPLGFRRKVKAKSKEAAQLVKVEQVGAGGGGLPAPPPPTRKLVFYTQLAHGSATGRVENF
TSIQELYAKIAGVFGISASEILYCTLNTPKVDMENLLGSYVGLEDFIFAHVKGNQKEVNV
YKSEDSLGLTITENGAGYAFIKRIKDGSLIDAVKTICVGDHIESINGENITGWRHYDVAK
KLKELKKGESFTLKLIEPKKAFEVEPRSKAGKSSEKIGTGRETLRLRSKGSASMEDMPSE
TKTKAIEKIDDLLELYMGIQDIDLATTMFEAGKDKGNPDEFAVALDETLGDFAFPDEFVF
DVWGVIGDAKRE
Download sequence
Identical sequences M3YH96
ENSMPUP00000010703 ENSMPUP00000010703 XP_004758195.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]