SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004758236.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004758236.1.14098
Domain Number 1 Region: 241-303
Classification Level Classification E-value
Superfamily Homeodomain-like 2.21e-20
Family Homeodomain 0.0033
Further Details:      
 
Domain Number 2 Region: 123-189
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000207
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 90-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000803
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004758236.1.14098
Sequence length 377
Comment PREDICTED: LIM/homeobox protein Lhx8 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MYWKSDQMFVCKLEEKDVPELAVPTEKCQGLMSEECGRIAALAAGRTRKGAGEEGLVSPE
GAGDEDSCSSSAPLSPSSSPRSMASGSVCPPGKCVCNSCGLEIVDKYLLKVNDLCWHVRC
LSCSVCRTSLGRHTSCYIKDKDIFCKLDYFRRYGTRCSRCGRHIHSTDWVRRAKGNVYHL
ACFACFSCKRQLSTGEEFALVEEKVLCRVHYDCMLDNLKREVENGNGISVEGALLTEQDV
NHPKPAKRARTSFTADQLQVMQAQFAQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRAR
HKKHVSPNHSSSAPVTAVPPSRLSPPMLEEMVYSAYVPQDGTMLTALHSYMDAHSPTTLG
LQPLLPHSMTQLPISHT
Download sequence
Identical sequences M3YHR7
ENSMPUP00000010874 ENSMPUP00000010874 XP_004758236.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]