SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004758875.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004758875.1.14098
Domain Number 1 Region: 478-658
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-50
Family SPRY domain 0.00078
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.68e-17
Family B-box zinc-binding domain 0.0000362
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 5.81e-16
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 4 Region: 372-483
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000171
Family Fibronectin type III 0.002
Further Details:      
 
Weak hits

Sequence:  XP_004758875.1.14098
Domain Number - Region: 108-161
Classification Level Classification E-value
Superfamily RING/U-box 0.000636
Family ZZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004758875.1.14098
Sequence length 667
Comment PREDICTED: E3 ubiquitin-protein ligase Midline-1 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVSHCATNESVESITAFQCPTCR
HVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDANTMTSAEKVLCQ
FCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHED
EKVNMYCVTDDQLICALCKLVGRHRDHQVAALSERYDKLKQNLESNLTSLIKRNTELETL
LAKLIQTCQHVEVNASRQEAKLMEECDLLIEIIQQRRQIIGTKIKEGKVMRLRKLAQQIA
NCKQCIERSASLISQAEHSLKENDHARFLQTAKSITERVSMATASSQVLIPEINLNDTFD
TFALDFSREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI
FTGQANVVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFIVKAINQAGSRSSEPGKLK
TNSQPFKLDPKSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQGSYGVAGNVFIDSGR
HYWEVVISGSTWYAIGLAYKSAPKHEWIGKNSASWALCRCHNNWVVRHNSKETPIEPAPH
LRRVGILLDYDNGSIAFYDALNSIHLYTFDITFSQPVCPTFTVWNKCLTIITGLPIPDHL
DCTEQLP
Download sequence
Identical sequences M3XTS6
ENSMPUP00000002476 XP_004758872.1.14098 XP_004758873.1.14098 XP_004758874.1.14098 XP_004758875.1.14098 XP_004758876.1.14098 ENSMPUP00000002476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]