SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004758898.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004758898.1.14098
Domain Number 1 Region: 399-543
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.23e-27
Family MAM domain 0.00081
Further Details:      
 
Domain Number 2 Region: 49-207
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000126
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 3 Region: 138-263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000345
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004758898.1.14098
Sequence length 552
Comment PREDICTED: epidermal growth factor-like protein 6 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MPPHWALALPLLFPWVAGGLGNAASPKDHGLSPPALQPGVCRYGTKLACCYGWRRNSKEV
CEATCERGCKFGECVGPNKCRCFPGYTGKTCSQDVNECGVKPRPCQHRCVNTHGSYKCFC
LSGHVLMPDATCANSRTCAMVSCQYACEDTEEGPRCLCPSPGLRLAPNGRVCTDIDECAS
GKAVCPYNRRCVNTFGSYYCKCHVGFELKYTRGRYDCVDINECAMNTHTCSLYANCLNSQ
GSFKCKCKQGYKGNGLQCSVIPENSVKEVLRAPGTIKDRIKKLLAHKNSMKKKVKIKNVI
TEPSGTPAPKVNLRPLNSEETVSRARNSNGGKKQKDGRKKEGLEDEEKNEKALKNHIEWE
QSLRGDVFSPKVNEAGGLGLVLVDGKLTSRLEHKDLNISVDCSFDHGVCDWKQDIEDDFD
WNPADRDNAVGYYMAVPAVAGRRDIGRLKLLLRDLQPQSNFCLLFDYRLAGEKVGKLRVF
VKDSNNILAWEETGSEDERWKTGTVPLYQGIATTKSVIFEAERGKGKRGEIAVDGVVLLS
GLCPDDLLSATG
Download sequence
Identical sequences M3XTZ2
XP_004758898.1.14098 ENSMPUP00000002542 ENSMPUP00000002542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]