SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004758983.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004758983.1.14098
Domain Number 1 Region: 40-155
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.54e-37
Family MBT repeat 0.00000682
Further Details:      
 
Domain Number 2 Region: 130-231
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.2e-35
Family MBT repeat 0.00000151
Further Details:      
 
Domain Number 3 Region: 603-684
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.81e-19
Family SAM (sterile alpha motif) domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004758983.1.14098
Sequence length 686
Comment PREDICTED: sex comb on midleg-like protein 2 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MDVKKENQEKPPHSGTSVQNDDFHWENYLKETGSLSAPSECFRQSKVPPANDFKVGMKLE
AHDPRNMTSICIATVVGITGARLRLRLDGSDNRNDFWRLVDSPDIQPIGTCEKEGDLLQP
PLGYQMNASSWPMFLLRTLNGSEMAPATIFKKEPPKPPLNNFKVGMKLEAIDKKNPYLIC
PATIGDVRGDEVYITFDGWSGAFDYWCKYDCRDIFPVGWCRLTGDVLQPPGTHVPVTKNI
AKTQSSLSKATQHSMQSPQKTAVILPTQQIRKSGRIKPPGQTSVPKKGSAVKNITPRKKG
PKKEKYFPVLCSTSSASIKSLARDRRVSYDKDATPGTSKIVMSTVCVYVNKHGNSGPHLD
QKKIQQLPDHFGPGPVNVVLRRTVQACVDCAIESKTVFGFLKPDHRGGEVITASFDGETH
SIQLPPVNSASFALRFLETLCHSLQCDNLLSSQPFSSYRGNTSSPAEHDKKSVKEDITQK
SPKRPSQEPPPYVVPVSPKLPKTKVYASKEEQLSCEGSGMPKEEKLPEDSENSPPNPANS
LSPTSRNPVSTHAAVSWSFSPSAPSTSSSALVGTKSTKSSHHEVKFQMQRKSEAPSYIAV
PDPSVLKQGFSKDPSTWSVDEVIQFMKHKDPQISGPLADLFRQHEIDGKALLLLKSDVMM
KYMGLKLGPALKLCYYIEKLKEGKYN
Download sequence
Identical sequences M3XUT3
ENSMPUP00000002833 XP_004758983.1.14098 ENSMPUP00000002833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]