SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004759906.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004759906.1.14098
Domain Number 1 Region: 410-518
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-25
Family PDZ domain 0.0033
Further Details:      
 
Domain Number 2 Region: 17-112
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-22
Family PDZ domain 0.0000856
Further Details:      
 
Domain Number 3 Region: 168-271
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-19
Family PDZ domain 0.025
Further Details:      
 
Domain Number 4 Region: 691-801
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000835
Family Nucleotide and nucleoside kinases 0.001
Further Details:      
 
Domain Number 5 Region: 519-595
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000617
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004759906.1.14098
Sequence length 1770
Comment PREDICTED: tight junction protein ZO-1 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MSARAAAAKNTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVL
KGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPD
PEPVSENEEDSYDEEVHDPRSSRGGLVSRRSEKSWARDRSASRERSLSPRSDRRSVASSQ
PAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENM
SLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHS
GRSHDRPPRHSRSRSPDQRSEPSDHSRHSPQQPSSGSLRSREEERISKPGAVSTPVKHAD
DHTPKTVEEVVVERNEKQAPTLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRP
SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIR
EEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKG
EVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRAD
FWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREK
LAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQ
WYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMND
GWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHT
SDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSP
QAQPQPIHRIDSPGFKTASQQKAEASSPVPYLSPETNPASSTSAVNHNVTLTNVRLEGPV
PAPSTSYSPQADSLRTPSTEAAHIMLRDQEPSLPSHVDPAKVYRKDPYPEEMMRQNHVLK
QPAVGHAGQRPDKEPNPSYESQPPYVEKQANRDLEQPTYRYDSSSYTDQFSRNYDHRLRY
EERIPSYEEQWSYYDDKQPYQPRPSFDNQHPRDPDSRQHPEESSERGYYPRFEEPASLPY
DSRPRFDQPPRTSTLRHEEQPTPGYDMHNRYRPEAQSYSSAGPKAPEPKQYFDQYPRSYE
QVPSQGFTSKAGHYEPLHGAAVVPPLIPASQHKPEVLPSNTKPLPPPPTLTEEEEDPAMK
PQSVLTRVKMFENKRSASLENKKDENHTAGFKPPEVASKPSGAPIIGPKATPQNQFSEHD
KTLYRIPEPQKPQMKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPPTHIPASHL
SEPAKPIHSQNQPNFSSYSSKGKSPEADGMDRSFGEKRYEPVQATPPPPPLPSQYTQPAQ
PSTSSSLALHTHAKGTHGEGSSVSLDFQNSLVSKPEPPPSQNKPATFRPPNREDTVQSTF
YPQKSFPDKAPVNGAEQTQKTVAPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETA
QKPDLSSKAPASPQTLVKPHGAAQPPEFDSGVETFSIHADKPKYQMNSISTVPKAIPVSP
SAVEEDEDEDGHTVVATARGVFNSNGGVLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRD
NSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSG
DPKTWQNKCLPGDPNYLVGANCVSVLIDHF
Download sequence
Identical sequences M3YHZ6
ENSMPUP00000010953 XP_004759906.1.14098 ENSMPUP00000010953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]