SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004760419.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004760419.1.14098
Domain Number 1 Region: 532-721
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.07e-55
Family Nucleotide and nucleoside kinases 0.00000000796
Further Details:      
 
Domain Number 2 Region: 404-560
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-32
Family SH3-domain 0.00000393
Further Details:      
 
Domain Number 3 Region: 303-400
Classification Level Classification E-value
Superfamily PDZ domain-like 1.3e-31
Family PDZ domain 0.0000197
Further Details:      
 
Domain Number 4 Region: 54-153
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-28
Family PDZ domain 0.0000223
Further Details:      
 
Domain Number 5 Region: 156-251
Classification Level Classification E-value
Superfamily PDZ domain-like 7.62e-26
Family PDZ domain 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004760419.1.14098
Sequence length 724
Comment PREDICTED: disks large homolog 4 isoform X5 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGE
MEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFV
NEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKLVEIKLIKGPKGLGFSIAGGVGN
QHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVY
LKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKD
LLGEEDVPRDPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQIL
SVNGVDLRSASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGT
ASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDS
ETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIIL
GPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIE
AGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLE
INKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPA
RERL
Download sequence
Identical sequences M3YGS9
ENSMPUP00000010536 XP_004760419.1.14098 ENSMPUP00000010536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]