SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004760529.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004760529.1.14098
Domain Number 1 Region: 690-936
Classification Level Classification E-value
Superfamily RNI-like 3.14e-43
Family 28-residue LRR 0.0000523
Further Details:      
 
Domain Number 2 Region: 1335-1418
Classification Level Classification E-value
Superfamily DEATH domain 1.27e-16
Family Caspase recruitment domain, CARD 0.017
Further Details:      
 
Domain Number 3 Region: 1-90
Classification Level Classification E-value
Superfamily DEATH domain 8e-16
Family Pyrin domain, PYD 0.00021
Further Details:      
 
Domain Number 4 Region: 289-463
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000266
Family Nucleotide and nucleoside kinases 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004760529.1.14098
Sequence length 1436
Comment PREDICTED: NACHT, LRR and PYD domains-containing protein 1 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MASGVQWRLARYLDMLGKEELKEFQLRLPEKPLGGPRPHLTSACGQQPGALEAASQLVAQ
HGEQQAWDLALHTWEQMGLSQLCAQARAEAALMSGEGSSLPCSPGAPSMQSPSGPTSTVV
LSFVQDPPTTSSKQPPGTSRCFLQNRYPSFSFNRVLPCSSNQKSLLQESPSAPTSTTVLE
DWVPPPQFSRKPRKQEAPRAEWLLVEMSGEHSKGIRERRQHQKRKRPRPTKSRGKEGLHE
EFIELLLLHQPRGGLLESQSKGSWHHSGAEEQGRLIEVKDLFGPGLGAQEEGRAVVLHGV
AGVGKSVMARQVRRAWEEGRLYRDRFQHVFYFSCRQLAQSKTMSLKELITKDWAAPTAPS
EQILSQPGQLLLILDGLDELKWVFVKEKSEVCPYWDQPQPVKTLLLGLLRKTILPGASLL
ITARTTALHLFILSVEQPRWVKVLGFSESSRKEYFYKYFKSKNKANRAFHSVELNQPLLT
MCLVPLVSWLVCTCMKKQMERGESLGLPSQTATALCLHYLAQALPAQPLGTQLRGLCSLA
AKGIRQRETLLIWEDLRKHELEDTVSALLEMGILRKHPSSPDYDFAHQYLQEFFAAVSCV
LGSEDKECHPPDSIQGLEDLLKAYGGLDPFGVPPTCFVLGLLSEPVQREMEAVFQGKVPA
ERKRKLLCWAKEAVRNQLPVLQQSSLPMLHCLYEIQDKDFLTHAMAPFHGARVRVHTSLE
LLVFMFCIKFCTVKELRLNERGQHGHTGSPLHVALLRGFPVTDAWWEVLFFTLRTTGKLK
ELDLSGNCLSNTVVQSLCKALRFPSCCLETLRLTHCSLTAEGCIGLAWVLDTPETLTELE
LSFNLLLDLGVERLCNGLKEPGCRLHRLRLVGCGLTSRCCRALASALSASPRLTELDLQQ
NELEDAGVRLLCEGLRRPTCQLRLLWLDQTGLSEEVTRMLRALEDEKPPLLIPSRWKPSE
TMPNEGPRETVPNEDPRETMPNEGPHEGETSGTSSLQQDRRESEGLSPPVVQEGLVGLLS
PAPPEDLQHKGPLGTEDDFWGPLGPVTIEMVDKDRSLHRVHLPMAGSYRWPSTGLRFVVR
EPATIDIEFCASDKFLHQMAWEQSWMVVGPLFDIKVKPGAVATVYLPHFVDLRGGCVDTS
LFQVAHFKEPGMLLEKPTRVELYHVVLEDPSFSPLGVFLRTIHAALRFLPITSMVLLYHH
TRPDETVFHLYLIPSDCCVRKAIDDEEKAFQFVQIRKPPPLGSLYLGSRYTVSSSETLEA
IPKELELCYRSPGQPQLYSEFYVGDLGSGLRLQLKDGSGAVVWEALVKPGDLQLTSSLVP
PAPAASPAPPGAPASLHFLDRHREQLVARVTTVDPVLDKLLGQVLSEEQYERVRAKATAA
NQMRELFRFSRSWDPACKDQVYQALKETHPYLIMELWETWGGDRERGTSPPTQPLP
Download sequence
Identical sequences M3YIL7
XP_004760529.1.14098 ENSMPUP00000011174 ENSMPUP00000011174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]