SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004760729.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_004760729.1.14098
Domain Number - Region: 133-247
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0398
Family Arfaptin, Rac-binding fragment 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004760729.1.14098
Sequence length 593
Comment PREDICTED: coiled-coil domain-containing protein 36 isoform X4 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MNFNVWNIKEMLSIPSGSGTTKSSSWNNNQADYSSLSDSQFLFGSQFCPESSETLSAPLD
GVHVRHPKQSQQNSLDSEPSIFTKYQTKPPLFGADANDRGLFPPPLSVGKAKGLLEQFEE
KKKRAKDKCDSETLYNLISHIRESIHRLQTSVEKSEEHLSSRSQSILDGLETLAKTLQET
VRAQSDLVLETVHDKGNMEQVIFEIQKRFEARQAEFIEMRSDLKHLEALVAQQSKDFQQL
CEQLGQLNVASVLAELKRLISDPRVAGHVKDSTSQTSPPLAQSLHFTRQGRYASEEAVLW
PAQAPAAVRTRSMGSLQPGEFGVCGERAESGALQEEAMRQAAGTSRSNRRVKDRAVQTNR
RNWTGPKTSSENHGAGSPGPEVLGGKDWVSPGASRLLPLDSNKFAASIKNTCPKCQAAGV
SPCDPREQRLVTAQKSRPVERGRKGRKQAPRKSQRGRLRARKQEQAPSKTCAVIPKYPQP
PVSGPQSPPLEQQKPRAQPLHLWGPNSPTKPVSAILGGRVMRTKAVRAAQGDLLELSGLS
SQDNSLLATSSQGDHQMSWFSDLNLGSSDPPVCKEPGKSMLYDLGFDSSDDGF
Download sequence
Identical sequences M3YQY8
XP_004760729.1.14098 XP_004760731.1.14098 XP_012916200.1.14098 XP_012916201.1.14098 ENSMPUP00000013747 ENSMPUP00000013747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]