SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004760854.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004760854.1.14098
Domain Number 1 Region: 682-939
Classification Level Classification E-value
Superfamily VPS9 domain 1.7e-43
Family VPS9 domain 0.006
Further Details:      
 
Domain Number 2 Region: 431-560
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.7e-26
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.013
Further Details:      
 
Domain Number 3 Region: 356-446
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.31e-17
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.014
Further Details:      
 
Domain Number 4 Region: 12-214
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000804
Family DBL homology domain (DH-domain) 0.009
Further Details:      
 
Weak hits

Sequence:  XP_004760854.1.14098
Domain Number - Region: 251-321
Classification Level Classification E-value
Superfamily PH domain-like 0.00255
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004760854.1.14098
Sequence length 951
Comment PREDICTED: ALS2 C-terminal-like protein isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MCSREEEALRRLEEVFSATLARINSLVLQPLLETTPEPSDPQVRECLRLVQQLHQSSQRL
WEVTEESLHSLRERLGHHDAVGLESLLLLRDADRVLQVHVEYIESYASCVAVQAFQKAAK
KRREFWRGQRKALGQLLSGVSSEAKVGTALTQALRQPLAHHVQQYVLLLLSLGDSVTEPH
PARELVVHAATLFGNLQSFMRQALDQALATQALWHSLSSRLRDVLCTPARRLLQDSQDVA
VTVTPLRAERVLLFNDALVLLQGHSVHTFDLKLVWVDPGQDGCTFQLLTPEDKLSFCSKN
AQDLMVWQWKVTQAVCQALRGKKDFPVLGTGLEPSEPPACRCVAYTFRAEGRLCQATYEG
EWCRGRPHGRGTLRWPDGRNHVGSFCQGLEHGFGIRLVPQASEDKFDCYKCHWREGSMCG
YGICEYGTDEVYKGYFWAGLRHGFGVLESAPQASQPCRYTGHWEKGQRSGYGIEEDSDRG
ERYIGMWQADQRHGPGVMVTQAGVCYQGTFQADKMVGPGILLSEDDSLYEGTFTRDLTLV
GKGKVTFPNGFTLEGSFGSGAGKGLHTQGVLDTAAFPPDPSSTRKRQLGVGAFPVESRWQ
GVYGPFRDFISAGCPGDEQEALLGFHVQNSRELRKSQEYLCCERTQPEACAGRMEDVLDE
LLLHREPRALRECLGKALSSSLHPLGKLLRTLMLTFQATYAGIGANKHLQTLAQEEVKQH
ARELWAAYRGLLQVALRRKGQAPEEDEDPEARDLQVHGLVLPLMLPSFYSELFTLYLLLH
ESEDSLYSQGIANLSLFPDTKLLEFLDVQKHLWPLKDLTLTTNQRLSLVRDKCFLSATEC
LQKIITTVDPREKLEVLEKTYGEIEATVSRVLGQEHKLPMDDLLPLLIYVVSRARIQHLG
AEIHLIRDMMDPIHTGGLYDFLLTALESCYEHIQKEDMHRFPGRWDSKDLW
Download sequence
Identical sequences M3YUP5
ENSMPUP00000015055 XP_004760854.1.14098 ENSMPUP00000015055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]