SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004760877.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004760877.1.14098
Domain Number 1 Region: 557-628
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000316
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 495-562
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000236
Family LIM domain 0.01
Further Details:      
 
Weak hits

Sequence:  XP_004760877.1.14098
Domain Number - Region: 467-493
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00176
Family LIM domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004760877.1.14098
Sequence length 671
Comment PREDICTED: LIM domain-containing protein 1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MDKYGDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQQ
QQLLQEETLPRGSRGPVNGGAPMGPQARRDAGVSSKLTVDGAAKPPLAASTVGPGTAPSV
VPGQPSYPPQEQRARTYARSASHSSQDYGSKESLAGWEMSGFRPLGSCEDPSCLTHGDYY
DNLSLASPKWADEPRVSPGIRPGAGSGWPGSPGTDAPLPKPSRDHPLCQPQLSLSSSRSL
ESSQDGAGGRGDEKPTGLWTTSSSPRVSPGLSSPGPENGAMVGPPPPRTSSFLAPLAQSC
PSQGALPRTNSGVGSEVSGLMPKATVDPQVWFQDGPKSYLSSSASSSSPASVDSMPSGAA
PGLGPKPVCTDPGVGPKLSPTSLVHPAMSTPPELSCKEGPPGWSSDGSLGPALLESPSPP
RVRLPCQTLVPGPELGPSAAELKLEALTQRLEREMDAHPKADYFGACVKCSKGVFGAGQA
CQAMGNLYHDACFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLCGHLIM
DMILQALGKSYHPGCFRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAACGLPIL
PPEGSDETIRVVSMDRDYHVECYHCEDCGLELNDEDGHRCYPLEDHLFCHSCHVKRLEQS
PASAALHQPRF
Download sequence
Identical sequences M3YV55
ENSMPUP00000015215 ENSMPUP00000015215 XP_004760877.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]