SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004762624.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004762624.1.14098
Domain Number 1 Region: 677-944
Classification Level Classification E-value
Superfamily RNI-like 5.1e-63
Family 28-residue LRR 0.0024
Further Details:      
 
Domain Number 2 Region: 17-104
Classification Level Classification E-value
Superfamily DEATH domain 2.35e-16
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 
Weak hits

Sequence:  XP_004762624.1.14098
Domain Number - Region: 193-298
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000771
Family G proteins 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004762624.1.14098
Sequence length 952
Comment PREDICTED: nucleotide-binding oligomerization domain-containing protein 1 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MEKQGHSEVGIISSESHSHVKLLKIHRELLVTHIRNTQCLVDNLLKNDYFSSEDAEIVGA
CPTQPDKVRKILDLAQSKGEEVSEFLLYVLQQLTDAYVDLRPWLSETGFSPSELIQSKVV
INTDPVSRYTEKLRQQLARDSKFVLCYAQKEELLLEETYSDTIVELVGFSNESLGPLESL
SCLLDHRTGVLSEQGETIFICGDAGVGKSMLLQRLQSLWAAGRLDTEFKFFFHFRCRMFS
CFKEGDTLCLRDLLFKHYCYPEQDPEEVFAFLLRFPQTALFTFDGLDELHSDFDLSSALD
TCSPWEPAHPLVLLTNLLSGKLLKGAGKLLTARTGVEIPRQLLRKKVLLRGFSPSHLRAY
TKRMFPERAVQEHLLAQLEANPNLCSLCAVPLFCWIIFRCFQHFHSIWEGSAQLPDCTVT
LTDVFLLVTEVHLNRTQPTSLVQRNTRGQTETFHASRGTLRSLGQVAHGGMEKSLFVFRQ
EEVQAAGMQEGELQLGFLRAVPEQGLGGDQQSYEFFHITLQAFFTAFFLVVDDKVDTGQL
LRFFQEWAPGGAGAESCYPPCLPFPCLKGSGLAGEDPFKNKDHFQFTNLFLCGLLSKAKQ
KLLRHLVPTAALRRKRKALWAHLFASLRAHLQNLPRVKSGTFNQVQAMPTFVWMLRCIYE
TQSEKVGQLAAKGICANYLKLTFCNVCSADCSALSFVLHHLRKRLALDLDNNNLNDYGVR
ELQPCFSRLTVIRLSVNQITDSGVKVLYEELTKYKILTFLGLYNNQITDVGARYIARILD
ECKGLTHLKLGENKITSEGGKCLAVAVKNSKSIFEIGMWGNRIGDEGAKAFAEALRNHPS
LTNLSLAFNGISREGGKSLAQALEQNTSLRIFWLTKNELDDEVAESLAEMLKVNQTLKHL
WLIQNQITAKGIAQLADALQRNTGIMEICLNGNLIKPEEAKVFEDEKRIICF
Download sequence
Identical sequences M3Y131
ENSMPUP00000005032 XP_004762622.1.14098 XP_004762624.1.14098 ENSMPUP00000005032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]