SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004763307.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004763307.1.14098
Domain Number 1 Region: 319-396
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.92e-23
Family Intermediate filament protein, coiled coil region 0.0000878
Further Details:      
 
Domain Number 2 Region: 89-122
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000204
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004763307.1.14098
Sequence length 544
Comment PREDICTED: neurofilament light polypeptide [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MSSFSYDPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSS
SSSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEA
ELLVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEE
EVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEIAFLKKVHEEEIAELQAQIQY
AQISVEMDVSSKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVR
AAKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELR
TTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYSQSSQVF
GRSAYGGLQTSSYLMSARSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSEGEAEEE
EKEKEEAAEEEGAEEEEAAKEESEEAKEEEEGGEGEEGEETKEAEEEEKKDEGAGEEQAT
KKKD
Download sequence
Identical sequences M3XVW1
ENSMPUP00000003211 XP_004763307.1.14098 ENSMPUP00000003211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]