SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004763346.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004763346.1.14098
Domain Number 1 Region: 447-513
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-21
Family SH3-domain 0.001
Further Details:      
 
Domain Number 2 Region: 507-595
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-19
Family SH3-domain 0.00074
Further Details:      
 
Domain Number 3 Region: 672-731
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-19
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004763346.1.14098
Sequence length 732
Comment PREDICTED: vinexin isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MARIPGIGRSSASPSLESKEEHERDVALLSRKDSDRGHTEEQLAHPEPSNLDPSMQAPPC
NLPTGLSLDDFIPSNLRAHGGSSSRGARVPVIRNGGSNTLNFQFHDPAPRTVCNGHVTQR
RDVSRHPDPAWYQTWPSPGSRPSGSQKTPASQHPQNWSATWTKDSKRRDKRWVKYEGIGP
VDESGMPIAPRSSVDSPRDWYRRMFQQIHRKMPDLQLDWTFEESPKVASSCAASTDSRHP
GPQQRPAARPGQASSLSGRSWDPSEEFPRSTFNSNPGAASLHQTPNQVLRCQERADNVWT
EDSWNQFLQELETGQKPKKPLVDDPVEKPSQRIEVLLERELAKLSAELDKDLRAIETRQP
SPKSSQVPRRSREPRPSARPAPAWSSSSPNALYLGSSRPLSPHRMADGASPFLGRRDFVY
PSSARDPSASERGGSPARKEEKKRKAARLKFDFQAQSPKELTLKKGDIVYIHKEVDKNWL
EGEHHGRLGIFPANYVEVLPADEIPKPIKPPSYQVLEYGEAVAQYNFKGDLEVELSFRKG
ERIGLIRKVNENWYEGRIAGTGRQGIFPASYVQVHREPRLRICDEGPQLPASPRLTAARL
ARHSGSPVTPHNPVDPTDWGSRTSPRRTGFSFPSQEPRAQNQGLSTPGSALSHPGGSSHP
LDVGGMPPNSTQIHWTPYRAVYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQK
FGTFPGNYVAPV
Download sequence
Identical sequences M3XWY1
ENSMPUP00000003581 XP_004763346.1.14098 ENSMPUP00000003581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]