SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004763382.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004763382.1.14098
Domain Number 1 Region: 146-272
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-35
Family Phosphotyrosine-binding domain (PTB) 0.00019
Further Details:      
 
Domain Number 2 Region: 6-110
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000113
Family Phosphotyrosine-binding domain (PTB) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004763382.1.14098
Sequence length 407
Comment PREDICTED: docking protein 2 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MEEVAVKQGFLYLLQQQTFGKKWRRFGAVLYGESDCALARLELQEGPEKPRRGEAARRVI
RLSDCLRVAEASGEASSPRDTSAFFLETKERQYQLAAPASERSDWIQAICLLAFPGQRKE
LLGPTGKGSRPRMEENELYSSTTAVAPRKEFVVTMRPTEASERCRLRGSYTLRAGETALE
LWGGHELGSKLYEWPYRFLRRFGRDKVTFSFEAGRRCISGEGNFEFETRQGNEIFSALEE
AISAQKNSTHPGPPSQPATVPAVLPRPESPYSRPHDSLPPPSPSTPVPSARPRGPEGEYA
VPFDAVARNLGKSLRGVLAVPPHVPADPLYDSIEEHLPPRPDHIYDEPEGVAALSLYDSP
QEPQGEAWRRQATADRDRGLQRGQDLSAAGWPQGTEYDNVILKKGPK
Download sequence
Identical sequences M3XYR4
ENSMPUP00000004215 ENSMPUP00000004215 XP_004763382.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]