SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004763476.2.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004763476.2.14098
Domain Number 1 Region: 395-643
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.9e-98
Family STAT DNA-binding domain 0.0000000438
Further Details:      
 
Domain Number 2 Region: 215-395
Classification Level Classification E-value
Superfamily STAT 1.26e-56
Family STAT 0.0000115
Further Details:      
 
Domain Number 3 Region: 80-200
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 4.45e-44
Family Transcription factor STAT-4 N-domain 0.000000386
Further Details:      
 
Domain Number 4 Region: 644-780
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-43
Family SH2 domain 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004763476.2.14098
Sequence length 827
Comment PREDICTED: signal transducer and activator of transcription 4 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MTVMVFSAHVLSPLWRASGQETAGQCHGSMGANGPILCDLQVQADTRVDRWIQISSICKD
SSVWFRETSDRSLGAMHLGMSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQ
DWEAASNNETMATILLQNLLIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHV
AVVISNCLREERRILAAANMPVQGPLEKSLQNSSVSERQRNVEHKVAAIKNSVQMTEQDT
KYLEDLQDEFDYRYKTIQTMDQGDKNNALMNQEVLTLQEMLNSLDFKRKEALNKMTQIVN
ETDALVSSALMEELRDWQRRQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEE
QSTKMTYEGDPIPMQRAHLLERVTFLIYSLFKNSFVVERQPCMPTHPQRPMVLKTLIQFT
VKLRLLIKLPELNYQVKVKASIDKNVSTLSNRRFVLCGTHVKAMSIEESSNGSLSVEFRH
LQPKEMKSGAGGKGNEGCHMVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLP
NAWASIIWYNVSTSDSQNLVFFNNPPSATLSQLLEVMSWQFSSYVGRGLNSDQLNMLAEK
LTVQPSYNDGNLTWAKFCKEHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKE
KERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSENGEVRFHSVEPYNKGRLSALPFADI
LRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPI
STIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE
Download sequence
Identical sequences M3YM88
ENSMPUP00000012445 ENSMPUP00000012445 XP_004763476.2.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]