SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004763508.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004763508.1.14098
Domain Number 1 Region: 270-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 28-85
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 214-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 176-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.28e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 326-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.96e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 368-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000446
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 7 Region: 410-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000163
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004763508.1.14098
Sequence length 475
Comment PREDICTED: zinc finger protein 19-like isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAPIFYNAPALHREGAKVMAAMPLNAWHQLVTFKDVAVYFTRTEWAGLSPTQQALYRSVM
LENYGNLTSLGYPVPKPALISLLEGENLPWGLEAQENPSAEGTKDICKDTETSVGNESTS
TQGISEERDMILSHGLRKSAVQGANFLEACELEKHQEIPTVKNIKGKVPRMHCARKPFSC
EECGKCFSYFSYYVRHQRIHTGEKPFECNECGKAFNGNSSLIRHQRIHTGEKPYQCEECG
RAFNDNANLIRHQRIHSGDRPDLCGECANSFTSSSEFVIHQRIHTGERPYECNGCGKAFV
GNSPLLRHQKIHTGEKPYECNECGQSFGRTSPLSQHPRMHTGEKPYSCKICGQAFSFHTK
LTRHRRVHSEEKPFDCVDCGKAFSAQEQLKRHLRIHIQQASYLCDACGKVFTGKRNLLQH
QRSHTAEKAYKCVKYGKTFRSSSKRGHHERVHPGDKPVLDICHFGLPEFFTPFYW
Download sequence
Identical sequences M3Y946
ENSMPUP00000007853 ENSMPUP00000007853 XP_004763508.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]