SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004763697.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004763697.1.14098
Domain Number 1 Region: 256-353
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-27
Family PDZ domain 0.0092
Further Details:      
 
Domain Number 2 Region: 1153-1248
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-22
Family Interleukin 16 0.0000489
Further Details:      
 
Domain Number 3 Region: 1263-1365
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-20
Family Interleukin 16 0.0000791
Further Details:      
 
Domain Number 4 Region: 389-490
Classification Level Classification E-value
Superfamily PDZ domain-like 9.2e-20
Family PDZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004763697.1.14098
Sequence length 1376
Comment PREDICTED: pro-interleukin-16 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MSLQKRIFPRRENGTHDVAAKPSPVTTRHPRAADQEKKKGSLTSSLRMDPHGRSGRSRKS
TKLRSISRSLMLCNAKTSDDGSSPDERYPDPFETSFVQGKEGIFHSSVQLADTSEAGPSS
IPDLALASEAVQVQAAGGDRGKSCRRLLFMKEASTTSSREKSGKVEAQSSTFLLPKACHQ
RTRSNSTSVNPYCTGEIDFPMIKKSPACADRQPYSLCSSRKSLSQQLDCPAGRAAGTSRP
TRSLSTAQLAQPTGGLQASVISNIVLMKGQAKGLGFSIVGGKDSIYGPIGIYVKTIFPGG
AAAADGRLQEGDEILELNGESMAGLTHQDALQKFKQAKKGLLTLTVRTRLTAPHSLSSHL
SPPLCHSLSSSSCATKDGSSFGLESPAAPASTAKANYRVMVEVSLQKEAGVGLGIGLCSV
PYFQCISGIFVHTLSPGSVAHLDGRLRCGDEIVEINDSPVHCMTLNEVYAVLSRCSPGPV
PIIVSRHPDPQVSELQLKEVVAQAVENVKFGKERHQWSLEGVKRLESSWHGRPTLEKERE
KNSAPPHRRAQKVMIRSSSDSSYMSGSPGGSPISGCEQQPSDLEVPTHSPSLSQGQEPGT
LPTAPSRPPQESPPLPGTQDSHPPLKLKKSFEILVRKPTTSKPKPPPRKYFKSDSDPQKS
LVEREDAVGPSGHTVPLCGQEARERLPLTLPQEDTAGRVPCAPACCLGPEAGPPTAPSSE
AELGRRGGSPGAPASAVKHPLLKRQARMDYSLDSTVEDPWVRISDCIKNLFSPIMSENHG
HVPLPPSVGLGEEVGVRGHPDGTPSKPEAAGGAPKAYKLADGGTVKKGPPVAPKPAWFRQ
SLKSLRTRAQEPRRLPDTASPAQPTPAPRERPGPPTRTFSSSIKQRISSFETFGSSPLPS
RGAQRQSLQASWGEAAQAPGEQEGGQGPGRSGRGAPPTVELQPPEREPPSRGSPSSSENN
EPGVSASPLSGRQSVQKTPLRDPDPLSRLLSAQTEEPQGPIVKMPGQRARSFPLSRTQSW
EVKPLDEKTSKLYSISSQVSSAVMKSLLCLPSSVSWGQMPCSPKEGGSPASSAGDTPAAN
SSAETPASDTGFSLNLSELREYTEGLGEPTEAESWDHGSPQPGQSVISLLSSEELKKLIE
EVKVLDEATLKQLDNIHVTVLHKEEGAGLGFSLAGGADLENKVITVHRVFPNGLASQEGT
IQKGNEVLSINGKSLKGATHSDALAILRQARDPRQAVIVTRKPVLEATPDLNSSSDSTTA
ASEASDVSADSTETTVHTVTLEKTSAGLGFSLEGGKGSLLGDKPLTVNRIFKGAASEQSE
TIQPGDELLHLAGTAMQGLTRFEAWNIIKTLPDGPVPIVIRRKSHQAKGTAGAGDP
Download sequence
Identical sequences M3YVJ3
ENSMPUP00000015353 ENSMPUP00000015353 XP_004763697.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]