SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004764272.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004764272.1.14098
Domain Number 1 Region: 275-430
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.49e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000709
Further Details:      
 
Domain Number 2 Region: 431-596
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.85e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000175
Further Details:      
 
Domain Number 3 Region: 148-266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-34
Family Spermadhesin, CUB domain 0.000019
Further Details:      
 
Domain Number 4 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-33
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 5 Region: 642-794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.86e-28
Family MAM domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004764272.1.14098
Sequence length 926
Comment PREDICTED: neuropilin-2 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MDMFPLTWVFLALYFSGPEVRGQPDSPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSVL
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPKMEIILQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRS
STGILSLTFHTDMAVAKDGFSARYYLIHQDPPENFQCNVPLGMESGRIANEQISASSTYS
DERWTPQQSRLHGEDNGWTPNLDSSKEYLQVDLRFLTILTAIATQGAISRETQNGYYVKS
YKLEVSTNGEDWMVYRHGKNHKVFQANNDASEVVLNKLHMPLLTRFVRIRPQTWHSGIAL
RLELFGCRVTDAPCSNMLGMLSGLIPDSQISASSTREYLWSPSAARLVSSRSGWFPRIPQ
AQPGEEWLQVDLGVPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGRDWEYIQD
PRTQQPKLFEGNMHYDTPDIRRFDPVPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
VETLGPTVKSEETTTPYPIEEEATECGENCSFEDDKDLQLPSGFNCNFDFPEEPCGWMYD
HAKWLRSTWPGSSSPNDRTFPDDRNFLRLQSDGRREGQYARLISPPVHLPRSPVCMEFQY
QATGGRGVALQVVREASQESKLLWVIREDQGDEWKHGRIILPSYDMEYQIVFEGVIGKGR
SGEIAIDDIRISTDVPLENCMEPISAFAVDIPEIHGREGYEDEIDDEYEVDWSNSSSPTS
GSGAPSADKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSCTTL
ENYNFELYDGLKHKVKMNHQKCCSEA
Download sequence
Identical sequences M3XMY2
ENSMPUP00000000432 ENSMPUP00000000432 XP_004764272.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]