SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004764427.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004764427.1.14098
Domain Number 1 Region: 129-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.11e-18
Family LIM domain 0.0016
Further Details:      
 
Domain Number 2 Region: 188-254
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4e-18
Family LIM domain 0.0023
Further Details:      
 
Domain Number 3 Region: 67-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.95e-16
Family LIM domain 0.0044
Further Details:      
 
Domain Number 4 Region: 7-72
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000157
Family LIM domain 0.019
Further Details:      
 
Domain Number 5 Region: 250-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000055
Family LIM domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004764427.1.14098
Sequence length 279
Comment PREDICTED: four and a half LIM domains protein 2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MTERFDCHHCEESLFGKKYILREDSPYCVACFEALYASTCEECGKPIGCDCKDLSYKDRH
WHEACFQCFRCKSSLVDKPFAAKEDQLLCTDCYSHEYSSKCQECKKTIMPGTRKMEYKDS
SWHETCFVCRRCQQPIGTKSFIPKDNQNFCVPCYEKQYALQCVQCQKPITTGGVTYREQP
WHRECFVCTACKKPLSGQRFTSREEFPYCLSCFCDLYAKKCAGCTHPISGLGGTKYISFE
ERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
Download sequence
Identical sequences M3YHE7
ENSMPUP00000010754 ENSMPUP00000010754 XP_004764425.1.14098 XP_004764426.1.14098 XP_004764427.1.14098 XP_004764428.1.14098 XP_004764429.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]