SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004764826.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004764826.1.14098
Domain Number 1 Region: 352-417
Classification Level Classification E-value
Superfamily SH3-domain 3.65e-19
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004764826.1.14098
Sequence length 419
Comment PREDICTED: ABI gene family member 3 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MSLPALCKQVWVSHGEETKSSGVGWGGGQATNQEQGEAQNRRAPWGGSQRQGAMAELQQL
QEFEIPTGREALRGNHSSLLRVADYCVDNYVQATDKRKALEETMAFTTQALASVAYQVGS
LAGHTLRMLDLQAASLRQVEARVNTLGQMVNMHMEKVARREIGTLATVQRLPPGQKVIAP
DSLPPLTPYYRRPLNFGCLDDIGHGIKDLTTQLSRTGTLSRKSIKAPATPASATLGRPPR
IPEPVLLPVVPEGKLSAASSASSLASAGSGEGVGGVSTTKGQAAPPPPPLPSPPAPPPPP
ASEVFLPPPLLEEVSLPLPAPELPPPLDLPPPPPPDLDELGLPLLPPPDFGPEEPSWVPA
SYLEKVVTLYPYTRQKDNELSFTEGTIICITRRYSDGWCEGVSSEGTGFFPGNYVQPSC
Download sequence
Identical sequences M3YVA4
ENSMPUP00000015264 ENSMPUP00000015264 XP_004764826.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]