SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004765614.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004765614.1.14098
Domain Number 1 Region: 158-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000112
Family LIM domain 0.052
Further Details:      
 
Domain Number 2 Region: 218-281
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000465
Family LIM domain 0.017
Further Details:      
 
Weak hits

Sequence:  XP_004765614.1.14098
Domain Number - Region: 280-304
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0149
Family LIM domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004765614.1.14098
Sequence length 832
Comment PREDICTED: prickle-like protein 1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MPLEMEPKMSKLAFGCQRSSTSDDDSGCALEEYAWVPPGLRPEQIQLYFACLPEEKVPYV
NSPGEKHRIKQLLYQLPPHDNEVRYCQSLSEEEKKELQVFSAQRKKEALGRGTIKLLSRA
VMHAVCEQCGLKINGGEIAVFASRAGPGVCWHPSCFVCFTCNELLVDLIYFYQDGKIHCG
RHHAELLKPRCSACDEIIFADECTEAEGRHWHMKHFCCLECETVLGGQRYIMKDGRPFCC
GCFESLYAEYCEACGEHIGVDHAQMTYDGQHWHATEACFSCAQCKASLLGCPFLPKQGQI
YCSKTCSLGEDVHASDSSDSAFQSARSRDSRRSVRMGKSSRSADQCRQSLLLSPALNYKF
PGLSGNAEDTLSRKLDDLSLSRQGASFVNEEFWKGRVDHETPEDPEEWAEHEDYMTQLLL
KFGDKSLFQQQPNEIDIRASEHWISDNMVKTKTELKQNNQSLASKKYQSDMYWAQSQDGL
GDSAYGSHPGPASSRRLQELDLDHAAAGYNHEQTQWYEDSLECLSDLKPEQSVRDSMDSL
ALSNITGASVDGESKPRPSLYSLQNFEEMEAEDCEKMSNMGTLNSSMLHRSAESLKSLSS
ELCTEKIMPEEKPVHLPVLRRSKSQSRPQQVKFSDDVIDNGNYDNIEIRQPPMSERTRRR
VYHFEERGSRSHHHRRRRSRKSRSDNALNLVTERKYSPKDRLRLYTPDNYEKFIQNKSAR
EIQAYIQNADLYGQYAHATSDYALQNPGLPRFLGLYGEDDDSWCSSTSSSSDSEEEGYFL
GQPIPQPRPQRYAYYTDDLSSPTSALPTPQFGQRTTKSKKKKGHKGKNCIIS
Download sequence
Identical sequences M3XMP2
ENSMPUP00000000342 XP_004765614.1.14098 XP_004765615.1.14098 XP_004765616.1.14098 XP_004765617.1.14098 XP_004765618.1.14098 XP_012918475.1.14098 ENSMPUP00000000342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]