SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004765620.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004765620.1.14098
Domain Number 1 Region: 157-454
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-75
Family Protein kinases, catalytic subunit 0.000055
Further Details:      
 
Domain Number 2 Region: 1-115
Classification Level Classification E-value
Superfamily DEATH domain 6.59e-39
Family DEATH domain, DD 0.00000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004765620.1.14098
Sequence length 460
Comment PREDICTED: interleukin-1 receptor-associated kinase 4 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MNKPITSSTYVRCLNLGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTCELLFDWGTTNCTVGDLVDLLIQNEFFAAASLLLPDAVPKTVNILPSNEAVTV
QQKQLPLCGKDRTFVVPVQNLEQNFMPPDSSSPENPSLEGSDTRFHNFSFYELKNVTNNF
DERPISLGGNKMGEGGFGVVYKGFMNNKTVAVKKLAAMVDISTEELRQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDDTPPLPWHMRCKIAQDAANGIS
FLHENHHIHRDIKSANILLDKDFTAKISDFGLARASEKFSQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYVDTKMND
TDPASIEAMYCIASQCLHEKKNKRPDIKKVQQLLQDMTAS
Download sequence
Identical sequences G9K636
ENSMPUP00000000358 ENSMPUP00000000358 XP_004765620.1.14098 XP_012918479.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]