SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004765780.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004765780.1.14098
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.51e-32
Family PWWP domain 0.00000798
Further Details:      
 
Domain Number 2 Region: 347-426
Classification Level Classification E-value
Superfamily HIV integrase-binding domain 6.41e-30
Family HIV integrase-binding domain 0.00000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004765780.1.14098
Sequence length 531
Comment PREDICTED: PC4 and SFRS1-interacting protein isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFP
YSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQASTKQSNASSDVEVEEKETSVSKE
DTDHEEKASNEDVTKAIDITTPKAARRGRKRKAEKQIETEEAGVVTTATASVNLKVSPKR
GRPAATEVKIPKPRGRPKMVKQPCPSESDMVTEEDKSKKKGQEEKQPKKQLKKDEDGQKE
EDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQESEKKRKGGRNFQNPHRR
NMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK
NSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLY
NKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNG
GSDAQDSNQPQHNGDSSEESKDNHEASSKKKSSSEERETERETLKDSTLDN
Download sequence
Identical sequences M3XY73
ENSMPUP00000004024 ENSMPUP00000004024 XP_004765779.1.14098 XP_004765780.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]