SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004766137.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004766137.1.14098
Domain Number 1 Region: 195-273
Classification Level Classification E-value
Superfamily S13-like H2TH domain 8.98e-21
Family Middle domain of MutM-like DNA repair proteins 0.0062
Further Details:      
 
Weak hits

Sequence:  XP_004766137.1.14098
Domain Number - Region: 2-61
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.0188
Family N-terminal domain of MutM-like DNA repair proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004766137.1.14098
Sequence length 334
Comment PREDICTED: endonuclease 8-like 2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MPEGPSVRKFHRLVSPFVGQQVVKTGGSSQKLTPASLQSLWLQDTQVHGKKLFLRFEPDE
ELGSLDNISLPESLEKGERKEEAQDQKQASGPSSQKTSQPPSQSLEHVAPSGDSGLEGLR
GDAAVGAAERWLQVSFGMFGSIWVNEFSRAKKANKRGDWRDPIPRLVLYFGGGGFLAFYN
CQMSWSSSPVVRPASDILSEKFDRRQALEALSQEQPVCYTLLDQRYFSGLGNIIKNEALY
RAGIHPLSLGSLLSHQHLEALVDHVVEFSVDWLQGKFEGRQQHPQIYQKEQCPGGHRVMR
EAFGPPGGFQRLTWWCPQCQPRLSPDEQGQVQLS
Download sequence
Identical sequences M3XRV2
XP_004766136.1.14098 XP_004766137.1.14098 ENSMPUP00000001802 ENSMPUP00000001802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]