SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004766191.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004766191.1.14098
Domain Number 1 Region: 166-368
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-56
Family DBL homology domain (DH-domain) 0.00021
Further Details:      
 
Domain Number 2 Region: 351-484
Classification Level Classification E-value
Superfamily PH domain-like 8.56e-30
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 
Domain Number 3 Region: 462-502,541-599
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.28e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0042
Further Details:      
 
Domain Number 4 Region: 630-727
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-16
Family Pleckstrin-homology domain (PH domain) 0.0000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004766191.1.14098
Sequence length 736
Comment PREDICTED: FYVE, RhoGEF and PH domain-containing protein 3 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MESGGGASTAQPPIAALGELNSGPGCSSPELSRADPGKLQALPLGPRAHGKDSDPGSPGS
PAAAGDGPPDTGPSGELDGGAKLPNRDSGIDSPSCSVANEQFPCGEGSEAGQGPTVLGPQ
LDGAPEGKALQEVADSDVGEGSGEEPDPENSPPGDLADPAKCSEPPKLLHIAQELLHTEE
TYVRRLYLLDQVFCTQLTEAGIPSEVTTGIFSNISSIYRFHGHFLLPELQTRITQEWDTN
PRLGDILQKLAPFLKMYGEYVKNFDRAMELVSAWTQRSPVFKDVVHRIQKQEVCGNLTLQ
HHMLEPVQRVPRYQLLLKDYLKRLPGDAPDRKDAERSLELISTAANHSNAAIRKMEKMHK
LLEVYERLGGEEDIVNPANELIKEGPIQKLSAKNGTAQDRHLFLFNSMILYCVPKLRLMG
QKFSVREKMDISGLQVQDIVKPNAAPTFIITGRRRCLELQTRTEEEKKEWIQVIEATIER
HKQNSQTFKAFSGSFGQEEDPSLPPDSPVVGSSSEGPAVAASGGGGTAGPEPRRGSGKTR
RDKEKQGCRSCGETFNSITKRKHRCKLCGAVICGKCSEFKAENGRQSRVCRECFLTQQAV
PESPSPEAVPEEPKHGTENPVSVDPQPSMLCSSLQVSDSGVVWSEVWATIPASEPLELVL
HLQRDSQDGGPPRTIPLAGCTVSVLDPVERPDSRHVWRLQQAQQTLYLSTPSADLRQQWL
EALSAAARGDPGLVAL
Download sequence
Identical sequences M3XZH2
ENSMPUP00000004473 XP_004766190.1.14098 XP_004766191.1.14098 XP_004766192.1.14098 ENSMPUP00000004473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]