SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004766489.2.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004766489.2.14098
Domain Number 1 Region: 83-271
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 8.11e-56
Family CRAL/TRIO domain 0.000000093
Further Details:      
 
Domain Number 2 Region: 277-392
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 5.23e-37
Family Supernatant protein factor (SPF), C-terminal domain 0.00000269
Further Details:      
 
Domain Number 3 Region: 2-73
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.16e-19
Family CRAL/TRIO N-terminal domain 0.0000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004766489.2.14098
Sequence length 397
Comment PREDICTED: SEC14-like protein 4 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MSGRVGDLSPQQQEALARFRDNLQDLLPTLPNADEYFFLRWLRARNFDLQKSEDMLRKHM
EFRKQQDLDNILSWKPSEVIQLYDSGGLSGYDYEGCPVWFDIIGTLDPKGLLLSASKQEL
IRKRIRVCELLLRECELQSQKLGRKIETVLMVFDMEGLSLKHLWKPAVEVYQQFFAILEA
NYPETIKNLIVIRAPKLFPVAFNLVKFFMSEETQRKIVILGGNWKQELPKFISPDQLPVE
FGGTMTDPDGNPKCLTKIKYGGDVPKSYYLRNQVKTQYEHTVTVARGSFMQVENEILFPG
CVLRWQFASEGADIGFGVFLKTKMSEQKQAGDMVEVLPIQRCKAHVVPEDGSLTCLKAGV
YILRFDNTYSLMHAKKVSYTVEVLLPDKASEEKLQGL
Download sequence
Identical sequences M3YNF5
ENSMPUP00000012862 XP_004766489.2.14098 ENSMPUP00000012862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]