SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004767627.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004767627.1.14098
Domain Number 1 Region: 467-541
Classification Level Classification E-value
Superfamily HMG-box 0.000000000000089
Family HMG-box 0.0021
Further Details:      
 
Domain Number 2 Region: 22-81
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000432
Family HLH, helix-loop-helix DNA-binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004767627.1.14098
Sequence length 584
Comment PREDICTED: basic helix-loop-helix and HMG box domain-containing protein 1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MWGSSRHLYSLGWPRASSLGSSDRRQRKNHTSKLHELALLLPVALKTGTKKLTKKEILLH
VLHYIQHLQRSIDVAKTLLKFHTTNGEGGLRGLGRNWGSGPARRRHSTPSSSPHSRKSRL
QGACRKPRKKKPTGLSEGQSRAQNPRRCLDLDKLKKWVALSPEQQGRNTGGTVTPSRHAS
SCCHPKVASSLPQSDRKGGRSRLTLLDMAENSSHCDCSGCCCRVSAQGDGLYQAFKAQQG
AERIHFLNRTQPCPRQKLVFYDSSEDLDKESPDADPWLPAWTPEGSPTGSPLALGPPQIN
SCTMSGHPSAILGLSPSLFSSPGKLLPEQILGDGTEFLTQALFEDVFLDPESSPTGGVLE
GLQDEEMPPAPPEDPADSHSLCQSSVSLDHCYLSLSENSKAPSGSSSSWEGSEAESLWRR
QEDAQANPKGPLSSSDEDGDYTWTPTRRAASLPAAGRKVRKGPAKLKENKKASCPTQTKK
KCVNGFIMFCRMNRKQYIRACPGTASTAATKELAQLWRVMTQQERRPYCIKARRFSLQHN
RIVKQDSSSSEDEDWGTPKPFYQLLAEKARRSPDLAPLLPPQHH
Download sequence
Identical sequences M3Y2X2
XP_004767627.1.14098 ENSMPUP00000005673 ENSMPUP00000005673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]