SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004767725.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004767725.1.14098
Domain Number 1 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.26e-23
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 2 Region: 447-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.13e-23
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 391-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-22
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 4 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 167-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.61e-21
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 6 Region: 2-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 7 Region: 489-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-19
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 8 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.54e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 111-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004767725.1.14098
Sequence length 552
Comment PREDICTED: zinc finger protein 404 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAQVPLTFSDIAIDFSLEEWECLNSDQRDLYRDVMLENYTNLVSLDFDFTTETNKLSSEK
SSYQVNSYHRETMKRNKTFNLMRFTLRNDPQCRIEFGREQGPNMEGFSQMTFIKHISLPL
HQRIHTKEKSYECKQCRRDFRKYSHLTEHFRDHNGVRPYECKECGKAFIVLQHFVRHKKI
HTDLKPYECNGCEKAFRFYSQLIQHQIIHTGVKPYECKQCGKSFRRYSHLTEHQKIHIGL
KPYECKECGETFRLYRHMCLHQKIHHGVKPYICKECGKAFGHRSSLYQHKKIHSGEKPYK
CKQCGKAFVRSYLLIEHQRSHTGEKPHECKECGKAFSRGSSLLKHKRIHSSEKLYDCKDC
GKAFCRGSQLTQHQRIHTGEKPHECKECGKTFKLHSYLIQHQIIHTDLKPYECKQCGKAF
SRIGDLKTHQSIHAGEKPFECKECGKTFRLNSQLIYHQTIHTGLKPYICKECKKAFRSIS
GLSQHKRIHTGEKPYECKECGKAFNRSDRLTQHQRIHTGVKPHKCKECGKTFTRCYQLTQ
HQRFHSGEKLLR
Download sequence
Identical sequences M3Y572
ENSMPUP00000006473 XP_004767722.1.14098 XP_004767723.1.14098 XP_004767724.1.14098 XP_004767725.1.14098 ENSMPUP00000006473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]