SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004767949.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004767949.1.14098
Domain Number 1 Region: 149-217
Classification Level Classification E-value
Superfamily Homeodomain-like 2.87e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 56-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000143
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 24-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000214
Family LIM domain 0.02
Further Details:      
 
Weak hits

Sequence:  XP_004767949.1.14098
Domain Number - Region: 116-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0727
Family FwdE C-terminal domain-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004767949.1.14098
Sequence length 390
Comment PREDICTED: LIM/homeobox protein Lhx4 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MMQSAAVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADC
QMPLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIIC
NRQLATGDEFYLLEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKSAYKNSP
KPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRAGGKQ
EKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQ
DLRDGSPYGAPQSPSSVSSLPSHAPLLHGLDYMVDSNLGIIAHAGQGVSQTRRAMAGGPT
SDISTGSSVGYPDFPTSPASWLDEMDHPPF
Download sequence
Identical sequences M3YJ54
XP_004767949.1.14098 ENSMPUP00000011361 ENSMPUP00000011361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]