SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004768339.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004768339.1.14098
Domain Number 1 Region: 2-249
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.41e-40
Family Patatin 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004768339.1.14098
Sequence length 253
Comment PREDICTED: patatin-like phospholipase domain-containing protein 4 isoform X3 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MKHINLSFAACGFLGIYHLGAASALCRHGQKLLKAVKAFAGASAGSLVASVLLTAPEKIE
ECNEFTYEFAEETRRQSFGAVTPGYDFMARLRSGMERILPSNAHELAHSRLHVSITNTKT
RENYLVSSFRSREDLIKVLLASSFVPIYAGLKPVEYRGQTWVDGGLTNSLPILPVGRTVT
ISPFSGRLDISPQDKGQLDLYVNLANQDVTLSVANLVRLNQALFPPCKRKMESLYQLGFD
DAIRFLLKENWFE
Download sequence
Identical sequences M3XPR2
ENSMPUP00000001062 ENSMPUP00000001062 XP_004768338.1.14098 XP_004768339.1.14098 XP_004768340.1.14098 XP_012919856.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]