SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004769039.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004769039.1.14098
Domain Number 1 Region: 589-957
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.62e-125
Family Oxysterol-binding protein 0.0012
Further Details:      
 
Domain Number 2 Region: 87-187
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-17
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004769039.1.14098
Sequence length 959
Comment PREDICTED: oxysterol-binding protein-related protein 6 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MSSDEKGISPAHKTSTPTHRSASSSTSSHRDSRQSIHVLERTASSSTEPSVSRQLLEPEP
VPLSKEADSWEIIEGLKIGQTNVQRPDKHEGFMLKKRKWPLKGWHKRFFVLDNGMLKYSK
APLDIQKGKVHGSIDVGLSVMSIKKKARRIDLDTEEHIYHLKVKSQDWFDAWVSKLRHHR
LYRQNEIVRSPRDASFHIFPSTSTAESSPAANVSVVDGKVPPNNFPWQSPLPCSNSLPAT
CTTGQSKVAAWLQDSEEMDRCAEDLAHCQSNLVELSKLLQNLEILQRTQSAPNFTDMQAN
CVDISKKDKRVTRRWRTKSVSKDTKIQLQEGPSAKGQFSTTRRRQRLAAAVATTVPFSAT
MSPVRLHSSNPNLCADIEFQTPPSHLTDPLESSTDYTKLQEEFCLIAQKVHSLLKSAFNS
IAIEKEKLKQMVSEQDHNKGHSTQMARLRQSLSQALNQNAELRSRLNRIHSESIICDQVV
SVNIIPSPDEAGEQIHVSLPLSQQVANESRLSMSESVSEFFDAQEVLLSASSSENEASDD
ESYISDVSDNISEDNTSVADNISRQILNGELTGGAFRNGRRTCLPAPCPDTSNINLWNIL
RNNIGKDLSKVSMPVELNEPLNTLQHLCEEIEYSELLDKASETDDPYERMVLIAAFAVSG
YCSTYFRAGSKPFNPVLGETYECIREDKGFRFFSEQVSHHPPISACHCESKNFVFWQDIR
WKNKFWGKSMEILPVGTLNVMLPKYGDCYVWNKVTTCIHNILSGRRWIEHYGEVTIRNTK
SSVCICKLTFVKVNYWNSNVNEVQGVVMDQEGKVVHRLFGKWHEGLYCGVAPSAKCIWRP
GSMPTNYELYYGFTRFAIELNELDPVLKDLLPPTDARFRPDQRFLEEGNLEAAAAEKQRV
EELQRSRRRYMEENNLEHIPKFFKKVIDANQREAWVSNDTYWELRKDPGFSKVDSPVLW
Download sequence
Identical sequences M3XVQ4
ENSMPUP00000003154 XP_004769039.1.14098 ENSMPUP00000003154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]