SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004769556.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004769556.1.14098
Domain Number 1 Region: 855-936
Classification Level Classification E-value
Superfamily DEATH domain 9.89e-22
Family DEATH domain, DD 0.00000838
Further Details:      
 
Domain Number 2 Region: 155-246
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000304
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 245-296
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000183
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 4 Region: 298-353
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 5 Region: 48-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000296
Family I set domains 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004769556.1.14098
Sequence length 945
Comment PREDICTED: netrin receptor UNC5B isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MWARSGARGALLLALLLCWDARLSQAGTDSGSEVLPDSFPSAPAEPLPHFLQEPQDAYIV
KNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQESLDEATGLRVREVQIEVSRQQVEEL
FGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDQEVLLQCRPPEGV
PVAEVEWLKNEDIIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTAA
ITVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTVCP
VDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCVQNKKTL
SDPKSHLLEASGDVALYAGLVVSAFVVVGVLIVVGGVVYRRNRRDFDTDITDSSAALTGG
FHPVNFKTARPNNPQLPHPSAPPDLTASAGIYRGPMYALQDSADKIPMTNSPLLDPLPNL
KIKVYNSGTTSSGPGLPDGADLLGVLPPGTYPGDFTRDAHLLHLRTASLGSQQLLGLPRD
PGSSVSGTFGCLGGRLNIPGTGVSLLVPNGAIPQGKFYEMYLLINKAENTLPLSEGTQTV
LSPSVTCGPTGLLLCRPVILTVPHCAEVSAGDWIFQLKTQAHQGHWEEVVTLDEETLNTP
CYCQLEARSCHILLDQLGTYVFTGESYSRSAVKRLQLAIFAPALCTSLEYSLRVYCLEDT
PVALKEVLELERTLGGYLVEEPKPLLFKDSYHNLRLSLHDIPHAHWRSKLLAKYQEIPFY
HIWSGSQKALHCTFTLERHSLASTELSCKICVRQVEGEGQIFQLHTTLAETPAGSLDTFC
SAPGSTVTTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKA
SPTGVILDLWEALQQDDGDLNSLASALEEMGKSEMLVAMATDGDC
Download sequence
Identical sequences M3XYI2
XP_004769556.1.14098 ENSMPUP00000004133 ENSMPUP00000004133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]