SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004770093.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004770093.1.14098
Domain Number 1 Region: 207-545
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.29e-102
Family Rap/Ran-GAP 0.000000817
Further Details:      
 
Domain Number 2 Region: 689-764
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000373
Family PDZ domain 0.011
Further Details:      
 
Weak hits

Sequence:  XP_004770093.1.14098
Domain Number - Region: 928-1023
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000157
Family Myosin rod fragments 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004770093.1.14098
Sequence length 1044
Comment PREDICTED: signal-induced proliferation-associated protein 1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MWAGGGVGSPRRGAAPAPTDDLFARKLRQPARPPLTPHTFEPRPARGPLLRSGSDAGEAR
PPTPASPRARAHSHEEASRPAAGPTRLFTDPLALLGLPAEEPEPAFPPVPEPHWFAHYDV
QSLLFDWAPKPRGTGGHAEATSGTPASAEDRSAGSDLLLEAPGFVSELGGEGELGLGGPV
PPPVPPALPNAAVSVLEEPQNRTSAYSLEHADLGAGYYRKYFYGKEHQNFFGLDEVLGPV
AVSLRREEKESSGGGTLHSYRIIVRTTQLRTLRGTISEDALPPGPPRGLSPRKLLEHVAP
WLSPTCLRLGSASPKVPRTLLTLDEQVLSFQRKVGVLYCRAGQASEEDMYNNREAGPAFM
QFLTLLGDVVRLKGFESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQQ
LLRKRHIGNDIVTIVFQEPGSKPFSPTTIRSHFQHVFLVVRADAPCTPHTSYRVAVSRTQ
DTPAFGPALPPGGGPFEANSDFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLAT
NEVTTTSLDSASRFGLPSLGGRRRAPPRGPGAELQAAGALVWGVRAAPGARGAAGAGVEA
GGPDDAEVPCLLGISAEALVLVAPRDGRVVFNCACRDVLAWTFSEQRLDLYYGRGEAITL
RFDGSPGQAVGEVVARLQLVSRGCESRELALPRDGQGRLGFEVDAEGFITHVERFTFAET
AGLRPGARLLRVCGQTLPTLGSEAAAQLLCSAPKVCVTVLPPDESGRPRRSFSELYTLSL
QEPSRRGPPEPVQEEAPGVVTLLPTTKQLLQLCLHDGGSPTGPGDLAEERTEFLHSQHSP
SPRSSLSDEAPVLPNTTPDLLLATTAKPAAPSTGRQTPPTQDGPSSPTGGEDRVDPAPEL
RASFLPRTLSLRNSISKIMSEAGSETLEDEWQSISEIASTCNTILQSLSREGQPIPENGD
GKGMPKADAEPEPGSLSEKVSHLEATLRKLQEDLEKERADRAALEEEVRSLRHNNRRLQA
ESESAANRLLLASKQLGTPTTDLD
Download sequence
Identical sequences M3YJP6
XP_004770093.1.14098 ENSMPUP00000011553 ENSMPUP00000011553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]