SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004770098.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_004770098.1.14098
Domain Number - Region: 42-74
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0741
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004770098.1.14098
Sequence length 199
Comment PREDICTED: Sjoegren syndrome/scleroderma autoantigen 1 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MALNGAEADDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTIL
LQDKQRKIYCVACQELDSDVDKDNPALNAQAALSQAREHQLASASELPSGSRPAPQPPVP
RPEHCEGAAAGLKAAQGPPPPVVPPNADVLACTQEALLQKLTWASAELGPSTSLETSIQL
CSLIRACAEALRSLRQLQH
Download sequence
Identical sequences M3YKI6
ENSMPUP00000011843 XP_004770098.1.14098 ENSMPUP00000011843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]