SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004770241.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004770241.1.14098
Domain Number 1 Region: 50-237
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.08e-52
Family Tpt1/KptA 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004770241.1.14098
Sequence length 274
Comment PREDICTED: tRNA 2'-phosphotransferase 1 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MGGLLRLGRRGRCDASELDFAMNSRGGRRQETTGSRGRRAHRPRGQDQDVQLSKALSYVL
RHGALKLGLPMRADGFVPLGTLLQLPQFHGFSAEDVQRVVDTNEKQRFALQPGDPGTGPL
IRANQGHSLQVPELELMPLETPQALPLRLVHGTFWQHWPSILLNGLSCRGRTHIHLALGL
PGDPGVISGMRPNCEVAVFIDGPRALADGIPFFRSANGVILTPGNADGFLLPKYFKEALQ
LRPTRKSLSLAGNEETEYQSGPKHSSRGSRMTQQ
Download sequence
Identical sequences M3YPB6
ENSMPUP00000013174 ENSMPUP00000013174 XP_004770241.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]