SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004770920.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004770920.1.14098
Domain Number 1 Region: 199-344
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-45
Family Third domain of FERM 0.00000026
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-38
Family Second domain of FERM 0.000000706
Further Details:      
 
Domain Number 3 Region: 498-586
Classification Level Classification E-value
Superfamily Moesin tail domain 3.01e-32
Family Moesin tail domain 0.0000241
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.86e-26
Family First domain of FERM 0.00000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004770920.1.14098
Sequence length 586
Comment PREDICTED: ezrin isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLK
LDKKVSAQELRKENPLQFKFRAKFYPEDVSEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKETHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEQKTKK
AEKELSDQIQRALQLEEERKRAQEEAERLEADRVAALRAKEELERQAADQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VSYHVQDNLQDEGTEYTGYSAELSSEGILDDRNEEKRITEAEKNERVQRQLMTLTNELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences M3Y1E5
ENSMPUP00000005146 ENSMPUP00000005146 XP_004770920.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]